Structure of PDB 6r25 Chain D Binding Site BS02

Receptor Information
>6r25 Chain D (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEA
SRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>6r25 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r25 A Tail-Based Mechanism Drives Nucleosome Demethylation by the LSD2/NPAC Multimeric Complex.
Resolution4.61 Å
Binding residue
(original residue number in PDB)		R30 Y37
Binding residue
(residue number reindexed from 1)		R6 Y13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6r25, PDBe:6r25, PDBj:6r25
PDBsum6r25
PubMed30970244
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]