Structure of PDB 8wh5 Chain C Binding Site BS02

Receptor Information
>8wh5 Chain C (length=88) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNA
ARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGV
Ligand information
>8wh5 Chain J (length=133) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgacacgtgcctggagactagggagtaatccccttgggcggttaaac
gcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacga
ccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wh5 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
Resolution3.58 Å
Binding residue
(original residue number in PDB)		R30 R33 R78
Binding residue
(residue number reindexed from 1)		R10 R13 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0009294 DNA-mediated transformation
GO:0009611 response to wounding
GO:0009617 response to bacterium
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wh5, PDBe:8wh5, PDBj:8wh5
PDBsum8wh5
PubMed38413824
UniProtQ9LD28|H2A6_ARATH Histone H2A.6 (Gene Name=RAT5)

[Back to BioLiP]