Structure of PDB 3dfv Chain C Binding Site BS02

Receptor Information
>3dfv Chain C (length=56) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dfv Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T326 N339 L343 H348 R352 Q362 T363 R364 R366
Binding residue
(residue number reindexed from 1)		T16 N29 L33 H38 R42 Q52 T53 R54 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3dfv, PDBe:3dfv, PDBj:3dfv
PDBsum3dfv
PubMed18621058
UniProtP23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=Gata3)

[Back to BioLiP]