Structure of PDB 2ql2 Chain C Binding Site BS02

Receptor Information
>2ql2 Chain C (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRMANNARERVRVRDINEAFRELGRMCQLHLKSDQTKLLILQQAVQVILG
LEQQVRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ql2 Crystal structure of E47-NeuroD1/beta2 bHLH domain-DNA complex: heterodimer selectivity and DNA recognition.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N548 T580 K581
Binding residue
(residue number reindexed from 1)		N6 T36 K37
Binding affinityPDBbind-CN: Kd=3.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:2ql2, PDBe:2ql2, PDBj:2ql2
PDBsum2ql2
PubMed18069799
UniProtP15806|TFE2_MOUSE Transcription factor E2-alpha (Gene Name=Tcf3)

[Back to BioLiP]