Structure of PDB 1h88 Chain C Binding Site BS02

Receptor Information
>1h88 Chain C (length=152) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNP
ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHL
NPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNST
MR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h88 Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
Resolution2.8 Å
Binding residue
(original residue number in PDB)
K113 R114 W115 R131 N164 R165 W166 A167 K182
Binding residue
(residue number reindexed from 1)
K75 R76 W77 R93 N126 R127 W128 A129 K144
Binding affinityPDBbind-CN: Kd=35.3nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h88, PDBe:1h88, PDBj:1h88
PDBsum1h88
PubMed11792321
UniProtP06876|MYB_MOUSE Transcriptional activator Myb (Gene Name=Myb)

[Back to BioLiP]