Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1axm Chain C Binding Site BS02

Receptor Information

>1axm Chain C (length=128) Species: 9606 (Homo sapiens)

KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKST
ETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFV
GLKKNGSCKRGPRTHYGQKAILFLPLPV

Ligand information

• Ligand ID: IDS
• InChI: InChI=1S/C6H10O10S/c7-1-2(8)4(16-17(12,13)14)6(11)15-3(1)5(9)10/h1-4,6-8,11H,(H,9,10)(H,12,13,14)/t1-,2-,3+,4+,6+/m0/s1
• InChIKey: COJBCAMFZDFGFK-VCSGLWQLSA-N
• SMILES:
  OpenEye OEToolkits 1.5.0: C1(C(C(OC(C1OS(=O)(=O)O)O)C(=O)O)O)O
  OpenEye OEToolkits 1.5.0: [C@@H]1([C@@H]([C@@H](O[C@H]([C@@H]1OS(=O)(=O)O)O)C(=O)O)O)O
  CACTVS 3.341: O[CH]1O[CH]([CH](O)[CH](O)[CH]1O[S](O)(=O)=O)C(O)=O
  CACTVS 3.341: O[C@@H]1O[C@H]([C@@H](O)[C@H](O)[C@H]1O[S](O)(=O)=O)C(O)=O
  ACDLabs 10.04: O=S(=O)(OC1C(O)C(O)C(OC1O)C(=O)O)O
• Formula: C6 H10 O10 S
• Name: 2-O-sulfo-alpha-L-idopyranuronic acid;
  O2-SULFO-GLUCURONIC ACID;
  2-O-sulfo-alpha-L-iduronic acid;
  2-O-sulfo-L-iduronic acid;
  2-O-sulfo-iduronic acid
• DrugBank: DB02264
• ZINC: ZINC000004096028
• PDB chain: 1axm Chain H Residue 4

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1axm Structure of a heparin-linked biologically active dimer of fibroblast growth factor.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): N18 K112 K113 K118
• Binding residue (residue number reindexed from 1): N9 K103 K104 K109
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0008083 growth factor activity

External links

• PDB: RCSB:1axm, PDBe:1axm, PDBj:1axm
• PDBsum: 1axm
• PubMed: 9655399
• UniProt: P05230|FGF1_HUMAN Fibroblast growth factor 1 (Gene Name=FGF1)

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417