Structure of PDB 1am9 Chain C Binding Site BS02

Receptor Information
>1am9 Chain C (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAID
YIRFLQHSNQKLKQENLSLRTAVHKSKSLKDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1am9 Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I331 E332 R334 Y335
Binding residue
(residue number reindexed from 1)		I13 E14 R16 Y17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1am9, PDBe:1am9, PDBj:1am9
PDBsum1am9
PubMed9634703
UniProtP36956|SRBP1_HUMAN Sterol regulatory element-binding protein 1 (Gene Name=SREBF1)

[Back to BioLiP]