Structure of PDB 8f16 Chain B Binding Site BS02

Receptor Information
>8f16 Chain B (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLK
MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYS
LAKEQRLNFGDDIPSALRIAKKKRWNSIEER
Ligand information
>8f16 Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PHEMCYWADAYCRYS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f16 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution1.56 Å
Binding residue
(original residue number in PDB)		F37 N65 L71 K95 F98 Q102 E106 D134 A138 I141
Binding residue
(residue number reindexed from 1)		F15 N43 L49 K73 F76 Q80 E84 D112 A116 I119
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f16, PDBe:8f16, PDBj:8f16
PDBsum8f16
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]