BioLiP

Structure of PDB 5wn5 Chain B Binding Site BS02

Receptor Information

>5wn5 Chain B (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDIL
CLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQAPLKV
SYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAF
RKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGE
LLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLL
PALCDSKIRSKALGSDHCPITLYLAL

Ligand information

>5wn5 Chain D (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctgatgcgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5wn5 Molecular snapshots of APE1 proofreading mismatches and removing DNA damage.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	Y171 N174 R177 N212 F266 W280 L282
Binding residue (residue number reindexed from 1)	Y129 N132 R135 N170 F224 W238 L240

Enzymatic activity

Catalytic site (original residue number in PDB)	N68 E96 D210 N212 D283 D308 H309
Catalytic site (residue number reindexed from 1)	N26 E54 D168 N170 D241 D266 H267
Enzyme Commision number	3.1.11.2: exodeoxyribonuclease III. 3.1.21.-

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0004518	nuclease activity
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:5wn5, PDBe:5wn5, PDBj:5wn5
PDBsum	5wn5
PubMed	29374164
UniProt	P27695\|APEX1_HUMAN DNA repair nuclease/redox regulator APEX1 (Gene Name=APEX1)