Structure of PDB 4umn Chain B Binding Site BS02

Receptor Information
>4umn Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIATKRLY
DEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4umn Structure of a stapled peptide antagonist bound to nutlin-resistant Mdm2.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		Q18 Q24 L54 F55 G58 I61 Y67 Q72 H73 V93 H96
Binding residue
(residue number reindexed from 1)		Q1 Q7 L37 F38 G41 I44 Y50 Q55 H56 V76 H79
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4umn, PDBe:4umn, PDBj:4umn
PDBsum4umn
PubMed25115702
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]