Structure of PDB 2ns8 Chain B Binding Site BS02

Receptor Information
>2ns8 Chain B (length=204) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLD
ALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHLGT
RPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHQV
AKEERETPTTDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQLTA
LLQI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ns8 How an agonist peptide mimics the antibiotic tetracycline to induce Tet-repressor
Resolution2.55 Å
Binding residue
(original residue number in PDB)		H64 F67 F86 R104 P105 Y110 L113 L131 L134 H139
Binding residue
(residue number reindexed from 1)		H61 F64 F83 R101 P102 Y107 L110 L128 L131 H136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ns8, PDBe:2ns8, PDBj:2ns8
PDBsum2ns8
PubMed17374541
UniProtP04483|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR)

[Back to BioLiP]