Structure of PDB 1h8p Chain B Binding Site BS02

Receptor Information

>1h8p Chain B (length=88) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVF
PFIYGGKKYETCTKIGSMWMSWCSLSPNYDKDRAWKYC

Ligand information

InChI=1S/C5H14NO4P/c1-6(2,3)4-5-10-11(7,8)9/h4-5H2,1-3H3,(H-,7,8,9)/p+1

YHHSONZFOIEMCP-UHFFFAOYSA-O

SMILES

Software	SMILES
ACDLabs 10.04	O=P(O)(O)OCC[N+](C)(C)C
CACTVS 3.341	C[N+](C)(C)CCO[P](O)(O)=O
OpenEye OEToolkits 1.5.0	C[N+](C)(C)CCOP(=O)(O)O

Formula

C5 H15 N O4 P

Name

PHOSPHOCHOLINE

ZINC000001532692

PDB chain

1h8p Chain B Residue 1111 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1h8p Sperm Coating Mechanism from the 1.8 A Crystal Structure of Pdc-109-Phosphorylcholine Complex
Resolution	1.82 Å
Binding residue (original residue number in PDB)	Y75 G87 W93 Y100 W106
Binding residue (residue number reindexed from 1)	Y54 G66 W72 Y79 W85
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008201	heparin binding

	Biological Process
GO:0007338	single fertilization
GO:0033700	phospholipid efflux
GO:0048240	sperm capacitation
GO:1902492	positive regulation of sperm capacitation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0009986	cell surface

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1h8p, PDBe:1h8p, PDBj:1h8p
PDBsum	1h8p
PubMed	11937055
UniProt	P02784\|SFP1_BOVIN Seminal plasma protein PDC-109

[Back to BioLiP]