Structure of PDB 1ebp Chain B Binding Site BS02

Receptor Information

>1ebp Chain B (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQL
EDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRY
HRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVD
VSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFW
SAWSEPVSLLT

Ligand information

>1ebp Chain D (length=16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TYSCHFGPLTWVCKPQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ebp Functional mimicry of a protein hormone by a peptide agonist: the EPO receptor complex at 2.8 A.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	L33 F93 P149 M150 T151 S152
Binding residue (residue number reindexed from 1)	L24 F84 P140 M141 T142 S143

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004896	cytokine receptor activity

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1ebp, PDBe:1ebp, PDBj:1ebp
PDBsum	1ebp
PubMed	8662530
UniProt	P19235\|EPOR_HUMAN Erythropoietin receptor (Gene Name=EPOR)

[Back to BioLiP]