Structure of PDB 1a1r Chain B Binding Site BS02

Receptor Information
>1a1r Chain B (length=179) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGV
CWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGS
SDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAV
GLFRAAVCTRGVAKAVDFIPVENLETTMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1r Crystal structure of the hepatitis C virus NS3 protease domain complexed with a synthetic NS4A cofactor peptide.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T30 A31 Y32 A33 Q34 Q35 T36 R37 C42 T45 S46 E56 E58 V59 I61 V62 S63 R88 T89 I90 A91
Binding residue
(residue number reindexed from 1)		T3 A4 Y5 A6 Q7 Q8 T9 R10 C15 T18 S19 E29 E31 V32 I34 V35 S36 R61 T62 I63 A64
Enzymatic activity
Catalytic site (original residue number in PDB) H83 D107 G163 S165
Catalytic site (residue number reindexed from 1) H56 D80 G136 S138
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a1r, PDBe:1a1r, PDBj:1a1r
PDBsum1a1r
PubMed8861917
UniProtP27958|POLG_HCV77 Genome polyprotein

[Back to BioLiP]