Structure of PDB 8b82 Chain A Binding Site BS02

Receptor Information
>8b82 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGI
FISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQ
MRVWRERM
Ligand information
>8b82 Chain D (length=10) Species: 333761 (human papillomavirus 18) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLQRRRETQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b82 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L738 I740 S741 I742 A743 G747 S748 T749 S761 R762 E792 H793 V797
Binding residue
(residue number reindexed from 1)		L30 I32 S33 I34 A35 G39 S40 T41 S53 R54 E84 H85 V89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b82, PDBe:8b82, PDBj:8b82
PDBsum8b82
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]