Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 5we0 Chain A Binding Site BS02

Receptor Information
>5we0 Chain A (length=220) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHE
KMPIFMDIAFIEYCFNLSLDPSQQILWEYSLISNALERLENIELERQNCM
RELLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDW
GSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTK
LQLEVFCDYDFKQREIVKML
Ligand information
>5we0 Chain C (length=17) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DNIFVKPGEDLEIPLLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5we0 Structural Basis for Shelterin Bridge Assembly.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T132 L133 E136 L140 C143 R150 E181 Y199 H203 M207 K211 R218 Q221 C222
Binding residue
(residue number reindexed from 1)		T108 L109 E112 L116 C119 R126 E157 Y175 H179 M183 K187 R194 Q197 C198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032200 telomere organization
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070187 shelterin complex
GO:0140445 chromosome, telomeric repeat region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5we0, PDBe:5we0, PDBj:5we0
PDBsum5we0
PubMed29149597
UniProtO13852|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417