BioLiP

Structure of PDB 5t2w Chain A Binding Site BS02

Receptor Information

>5t2w Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGN
HFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKE
FREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPH
KIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGI

Ligand information

>5t2w Chain D (length=27) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctgtccatcgctcacgtacagagctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t2w Structural Basis for Excision of 5-Formylcytosine by Thymine DNA Glycosylase.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R110 G138 I139 N140 G142 A145 Y152 G156 N157 N191 P198 G199 S200 K201 G231 K232 C233 F252 P270 S271 S273 A274 R275 C276 Q278
Binding residue (residue number reindexed from 1)	R3 G31 I32 N33 G35 A38 Y45 G49 N50 N84 P91 G92 S93 K94 G124 K125 C126 F145 P163 S164 S166 A167 R168 C169 Q171

Enzymatic activity

Catalytic site (original residue number in PDB)	N140 H151
Catalytic site (residue number reindexed from 1)	N33 H44
Enzyme Commision number	3.2.2.29: thymine-DNA glycosylase.

Gene Ontology

	Molecular Function
GO:0000700	mismatch base pair DNA N-glycosylase activity

	Biological Process
GO:0006285	base-excision repair, AP site formation

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:5t2w, PDBe:5t2w, PDBj:5t2w
PDBsum	5t2w
PubMed	27805810
UniProt	Q13569\|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)