Structure of PDB 5m61 Chain A Binding Site BS02

Receptor Information

>5m61 Chain A (length=360) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
DMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHT
MTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQI
INYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQ
FKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFP
PEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETI
FVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAV
RNNLAGAEEL

Ligand information

>5m61 Chain G (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ETLLDLDFDPFK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m61 Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
Resolution	1.84 Å
Binding residue (original residue number in PDB)	L183 V190 Q192 I231 P242 K245
Binding residue (residue number reindexed from 1)	L180 V187 Q189 I228 P239 K242

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030130	clathrin coat of trans-Golgi network vesicle
GO:0030132	clathrin coat of coated pit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m61, PDBe:5m61, PDBj:5m61
PDBsum	5m61
PubMed	27813245
UniProt	P49951\|CLH1_BOVIN Clathrin heavy chain 1 (Gene Name=CLTC)

[Back to BioLiP]