Structure of PDB 4iri Chain A Binding Site BS02

Receptor Information
>4iri Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iri Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		Q295 W334 K338 M343 K347 R350 Y354 Y355 K358
Binding residue
(residue number reindexed from 1)		Q4 W43 K47 M52 K56 R59 Y63 Y64 K67
Binding affinityPDBbind-CN: Kd=37nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4iri, PDBe:4iri, PDBj:4iri
PDBsum4iri
PubMed23898196
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]