Structure of PDB 1h0m Chain A Binding Site BS02

Receptor Information
>1h0m Chain A (length=230) Species: 358 (Agrobacterium tumefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQHWLDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAV
TNYHRQWQSTYFDKKFEALDPVVKRARSRKHIFTWSGEHERPTLSKDERA
FYDHASDFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAA
TIGQIHARISFLRTTDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNS
VRVKLREAMKRFDVRSKAHLTALAIRRKLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h0m The Crystal Structure of the Quorum Sensing Protein Trar Bound to its Autoinducer and Target DNA
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N203 R206
Binding residue
(residue number reindexed from 1)		N199 R202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0009372 quorum sensing
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h0m, PDBe:1h0m, PDBj:1h0m
PDBsum1h0m
PubMed12198141
UniProtP33905|TRAR_RHIRD Transcriptional activator protein TraR (Gene Name=traR)

[Back to BioLiP]