Structure of PDB 1eon Chain A Binding Site BS02

Receptor Information
>1eon Chain A (length=236) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVKSSLKTYNII
PKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSE
DEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eon Inhibition of EcoRV Endonuclease by Deoxyribo-3'-S-phosphorothiolates: A High-Resolution X-ray Crystallographic Study
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N70 L180 S183 G184 N185 T222 S223 R226
Binding residue
(residue number reindexed from 1)		N69 L171 S174 G175 N176 T213 S214 R217
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eon, PDBe:1eon, PDBj:1eon
PDBsum1eon
PubMed
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]