Structure of PDB 1e0o Chain A Binding Site BS02

Receptor Information

>1e0o Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKST
ETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFV
GLKKNGSCKRGPRTHYGQKAILFLPLPVS

Ligand information

Ligand ID

IDS

InChI

InChI=1S/C6H10O10S/c7-1-2(8)4(16-17(12,13)14)6(11)15-3(1)5(9)10/h1-4,6-8,11H,(H,9,10)(H,12,13,14)/t1-,2-,3+,4+,6+/m0/s1

InChIKey

COJBCAMFZDFGFK-VCSGLWQLSA-N

SMILES

Software	SMILES
OpenEye OEToolkits 1.5.0	C1(C(C(OC(C1OS(=O)(=O)O)O)C(=O)O)O)O
OpenEye OEToolkits 1.5.0	[C@@H]1([C@@H]([C@@H](O[C@H]([C@@H]1OS(=O)(=O)O)O)C(=O)O)O)O
CACTVS 3.341	O[CH]1O[CH]([CH](O)[CH](O)[CH]1O[S](O)(=O)=O)C(O)=O
CACTVS 3.341	O[C@@H]1O[C@H]([C@@H](O)[C@H](O)[C@H]1O[S](O)(=O)=O)C(O)=O
ACDLabs 10.04	O=S(=O)(OC1C(O)C(O)C(OC1O)C(=O)O)O

Formula

C6 H10 O10 S

Name

2-O-sulfo-alpha-L-idopyranuronic acid;
O2-SULFO-GLUCURONIC ACID;
2-O-sulfo-alpha-L-iduronic acid;
2-O-sulfo-L-iduronic acid;
2-O-sulfo-iduronic acid

PDB chain

1e0o Chain E Residue 6 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1e0o Crystal Structure of Fibroblast Growth Factor Receptor Ectodomain Bound to Ligand and Heparin
Resolution	2.8 Å
Binding residue (original residue number in PDB)	N18 K112 K113
Binding residue (residue number reindexed from 1)	N9 K103 K104
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005104	fibroblast growth factor receptor binding
GO:0005178	integrin binding
GO:0005515	protein binding
GO:0008083	growth factor activity
GO:0008201	heparin binding
GO:0030544	Hsp70 protein binding
GO:0044548	S100 protein binding

	Biological Process
GO:0001525	angiogenesis
GO:0001759	organ induction
GO:0007165	signal transduction
GO:0008284	positive regulation of cell population proliferation
GO:0008543	fibroblast growth factor receptor signaling pathway
GO:0009653	anatomical structure morphogenesis
GO:0009887	animal organ morphogenesis
GO:0010595	positive regulation of endothelial cell migration
GO:0010628	positive regulation of gene expression
GO:0030154	cell differentiation
GO:0030324	lung development
GO:0030334	regulation of cell migration
GO:0030335	positive regulation of cell migration
GO:0032148	activation of protein kinase B activity
GO:0034605	cellular response to heat
GO:0042060	wound healing
GO:0043406	positive regulation of MAP kinase activity
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045766	positive regulation of angiogenesis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050673	epithelial cell proliferation
GO:0050679	positive regulation of epithelial cell proliferation
GO:0051781	positive regulation of cell division
GO:0060681	branch elongation involved in ureteric bud branching
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0072163	mesonephric epithelium development
GO:1901509	regulation of endothelial tube morphogenesis
GO:1902533	positive regulation of intracellular signal transduction
GO:1903672	positive regulation of sprouting angiogenesis
GO:2000347	positive regulation of hepatocyte proliferation
GO:2000544	regulation of endothelial cell chemotaxis to fibroblast growth factor

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005938	cell cortex
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1e0o, PDBe:1e0o, PDBj:1e0o
PDBsum	1e0o
PubMed	11069186
UniProt	P05230\|FGF1_HUMAN Fibroblast growth factor 1 (Gene Name=FGF1)

[Back to BioLiP]