Structure of PDB 9fmd Chain 1 Binding Site BS02

Receptor Information
>9fmd Chain 1 (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMG
SSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIA
AEEQTAKRRKKRQKLKEKKLLAK
Ligand information
>9fmd Chain IN (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaaugaugucauacuuauccucag
..........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fmd Mechanism for the initiation of spliceosome disassembly.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		A72 G73 S76
Binding residue
(residue number reindexed from 1)		A53 G54 S57
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019901 protein kinase binding
Biological Process
GO:0003014 renal system process
GO:0006397 mRNA processing
GO:0006469 negative regulation of protein kinase activity
GO:0008380 RNA splicing
GO:0042326 negative regulation of phosphorylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fmd, PDBe:9fmd, PDBj:9fmd
PDBsum9fmd
PubMed38925148
UniProtQ9H875|PKRI1_HUMAN PRKR-interacting protein 1 (Gene Name=PRKRIP1)

[Back to BioLiP]