Structure of PDB 4dx9 Chain i Binding Site BS01

Receptor Information
>4dx9 Chain i (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CAEFRIKYVGAILEGPLDLINYIDVAQPFVPPMGVSGIKVSHRHALYLII
RMVCYDDGLGAGKSLLALKTTDYSLWVYQCNSLEQAQAICKVLSTAFDSV
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dx9 Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
C143 Q181
Binding residue
(residue number reindexed from 1)
C54 Q87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4dx9, PDBe:4dx9, PDBj:4dx9
PDBsum4dx9
PubMed23317506
UniProtO14713|ITBP1_HUMAN Integrin beta-1-binding protein 1 (Gene Name=ITGB1BP1)

[Back to BioLiP]