Structure of PDB 8wyi Chain a Binding Site BS01

Receptor Information
>8wyi Chain a (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLDPKLCYLLDGILFIYGVILTALFLRVKF
Ligand information
>8wyi Chain b (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDPKLCYLLDGILFIYGVILTALFLRVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wyi Structures of human gamma delta T cell receptor-CD3 complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
C32 Y33 D36 L39 F40 Y42 L46 T47 F50
Binding residue
(residue number reindexed from 1)
C7 Y8 D11 L14 F15 Y17 L21 T22 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8wyi, PDBe:8wyi, PDBj:8wyi
PDBsum8wyi
PubMed38657677
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]