Structure of PDB 8wlq Chain X Binding Site BS01

Receptor Information
>8wlq Chain X (length=133) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQV
DAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGE
MVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ
Ligand information
>8wlq Chain g (length=16) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGVPGALSNQPAPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wlq Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q46 V47 F49 S70
Binding residue
(residue number reindexed from 1)		Q45 V46 F48 S69
External links
PDB RCSB:8wlq, PDBe:8wlq, PDBj:8wlq
PDBsum8wlq
PubMed
UniProtP0A1I7|FLGC_SALTY Flagellar basal-body rod protein FlgC (Gene Name=flgC)

[Back to BioLiP]