Structure of PDB 7xw9 Chain R Binding Site BS01

Receptor Information
>7xw9 Chain R (length=288) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNC
YLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINAS
SCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFF
LLDLNISTYKDAIVISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYG
FIARILFLTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQE
NWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xw9 Cryo-EM structure of the TRH-bound human TRHR-Gq complex
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T102 Y106 L164 Y181 R185 Y282 N289 R306
Binding residue
(residue number reindexed from 1)		T90 Y94 L152 Y169 R173 Y234 N241 R258
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004997 thyrotropin-releasing hormone receptor activity
GO:0005515 protein binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xw9, PDBe:7xw9, PDBj:7xw9
PDBsum7xw9
PubMed36280665
UniProtP34981|TRFR_HUMAN Thyrotropin-releasing hormone receptor (Gene Name=TRHR)

[Back to BioLiP]