Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 7xow Chain R Binding Site BS01

Receptor Information
>7xow Chain R (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLL
LAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALER
YSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRV
LQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGKLLA
KKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHL
LSYASACVNPLVYCFMHRRFRQACLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xow Structural insights into human brain-gut peptide cholecystokinin receptors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		P114 G118 T119 M134 Y189 Q204 C205 H207 N353 R356 A363 H364 S368 I372 H376
Binding residue
(residue number reindexed from 1)		P62 G66 T67 M82 Y137 Q152 C153 H155 N226 R229 A236 H237 S241 I245 H249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004951 cholecystokinin receptor activity
GO:0005515 protein binding
GO:0015054 gastrin receptor activity
GO:0017046 peptide hormone binding
GO:0031741 type B gastrin/cholecystokinin receptor binding
GO:0046935 1-phosphatidylinositol-3-kinase regulator activity
Biological Process
GO:0001696 gastric acid secretion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008284 positive regulation of cell population proliferation
GO:0038188 cholecystokinin signaling pathway
GO:0045851 pH reduction
GO:0048565 digestive tract development
GO:0048732 gland development
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xow, PDBe:7xow, PDBj:7xow
PDBsum7xow
PubMed35672283
UniProtP32239|GASR_HUMAN Gastrin/cholecystokinin type B receptor (Gene Name=CCKBR)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417