Structure of PDB 7t10 Chain R Binding Site BS01

Receptor Information
>7t10 Chain R (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIAD
ELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSID
RYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQGR
SSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSVRL
LSGSREKDRNLRKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL
KGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t10 Plasticity in ligand recognition at somatostatin receptors.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D122 R184 Y205 F272 N276 P286 K291 F294 Y302
Binding residue
(residue number reindexed from 1)		D83 R145 Y165 F232 N236 P246 K251 F254 Y262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004994 somatostatin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t10, PDBe:7t10, PDBj:7t10
PDBsum7t10
PubMed35210615
UniProtP30874|SSR2_HUMAN Somatostatin receptor type 2 (Gene Name=SSTR2);
P41145|OPRK_HUMAN Kappa-type opioid receptor (Gene Name=OPRK1)

[Back to BioLiP]