BioLiP

Structure of PDB 7s8l Chain R Binding Site BS01

Receptor Information

>7s8l Chain R (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFL
FLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTER
CLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDS
GWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGLTRLYLTILLTVLVF
LLCGLPFGIQWFLILWIWDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSF

Ligand information

>7s8l Chain A (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KNFFWK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s8l Structure, function and pharmacology of human itch GPCRs.
Resolution	2.45 Å
Binding residue (original residue number in PDB)	N85 Y89 T106 M109 C168 F170 D184 W243
Binding residue (residue number reindexed from 1)	N58 Y62 T79 M82 C141 F143 D157 W211

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0042923	neuropeptide binding
GO:1990595	mast cell secretagogue receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway
GO:0019233	sensory perception of pain
GO:0030431	sleep
GO:0032467	positive regulation of cytokinesis
GO:0043303	mast cell degranulation
GO:0045576	mast cell activation

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:7s8l, PDBe:7s8l, PDBj:7s8l
PDBsum	7s8l
PubMed	34789874
UniProt	Q96LB1\|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 (Gene Name=MRGPRX2)