Structure of PDB 7s8l Chain R Binding Site BS01

Receptor Information
>7s8l Chain R (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFL
FLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTER
CLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDS
GWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGLTRLYLTILLTVLVF
LLCGLPFGIQWFLILWIWDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s8l Structure, function and pharmacology of human itch GPCRs.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		N85 Y89 T106 M109 C168 F170 D184 W243
Binding residue
(residue number reindexed from 1)		N58 Y62 T79 M82 C141 F143 D157 W211
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0042923 neuropeptide binding
GO:1990595 mast cell secretagogue receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019233 sensory perception of pain
GO:0030431 sleep
GO:0032467 positive regulation of cytokinesis
GO:0043303 mast cell degranulation
GO:0045576 mast cell activation
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7s8l, PDBe:7s8l, PDBj:7s8l
PDBsum7s8l
PubMed34789874
UniProtQ96LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 (Gene Name=MRGPRX2)

[Back to BioLiP]