Structure of PDB 7t2b Chain Q Binding Site BS01

Receptor Information
>7t2b Chain Q (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAV
TELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVN
VSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRN
GDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWK
Ligand information
>7t2b Chain R (length=14) Species: 1313 (Streptococcus pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATGLAWEWWRTVYE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t2b CD4 + T cell-mediated recognition of a conserved cholesterol-dependent cytolysin epitope generates broad antibacterial immunity.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G11 R12 Q13 E28 Y30 W61 K71 V74 R77 M78 H81 N82 L85
Binding residue
(residue number reindexed from 1)
G13 R14 Q15 E28 Y30 W61 K71 V74 R77 M78 H81 N82 L85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7t2b, PDBe:7t2b, PDBj:7t2b
PDBsum7t2b
PubMed37100059
UniProtP04440|DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain (Gene Name=HLA-DPB1)

[Back to BioLiP]