Structure of PDB 2aiz Chain P Binding Site BS01

Receptor Information
>2aiz Chain P (length=134) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILD
AHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVD
AGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2aiz Peptidoglycan recognition by pal, an outer membrane lipoprotein.
ResolutionN/A
Binding residue
(original residue number in PDB)		F36 D37 D71 R73 Y78
Binding residue
(residue number reindexed from 1)		F36 D37 D71 R73 Y78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009279 cell outer membrane
GO:0016020 membrane
GO:0019867 outer membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2aiz, PDBe:2aiz, PDBj:2aiz
PDBsum2aiz
PubMed16475801
UniProtP10324|PAL_HAEIN Peptidoglycan-associated lipoprotein (Gene Name=pal)

[Back to BioLiP]