Structure of PDB 1ngm Chain M Binding Site BS01

Receptor Information
>1ngm Chain M (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ngm Crystal structure of a transcription factor IIIB core interface ternary complex
Resolution2.95 Å
Binding residue
(original residue number in PDB)		V71 F116 S118 K120 Q158 N159 F190 R196 T215 G216
Binding residue
(residue number reindexed from 1)		V11 F56 S58 K60 Q98 N99 F130 R136 T155 G156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ngm, PDBe:1ngm, PDBj:1ngm
PDBsum1ngm
PubMed12660736
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]