Structure of PDB 3ck0 Chain L Binding Site BS01

Receptor Information

>3ck0 Chain L (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSP
KLLIYWASTRGSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNL
YTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNR

Ligand information

>3ck0 Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DRVYIHPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ck0 Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in Complex with Fab131: Making Angiotensin II Analogs
Resolution	3.0 Å
Binding residue (original residue number in PDB)	H31 T31C Y32 S91 Y92 N93 L94 Y95
Binding residue (residue number reindexed from 1)	H31 T34 Y38 S97 Y98 N99 L100 Y101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0030183	B cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3ck0, PDBe:3ck0, PDBj:3ck0
PDBsum	3ck0
PubMed
UniProt	P01837\|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]