BioLiP

Structure of PDB 3c2a Chain L Binding Site BS01

Receptor Information

>3c2a Chain L (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIY
GNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADW
VFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV
THEGSTVEKTVAPTEC

Ligand information

>3c2a Chain P (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KSIHLGPGRAFYA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3c2a Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
Resolution	2.1 Å
Binding residue (original residue number in PDB)	W91 A95B W96
Binding residue (residue number reindexed from 1)	W92 A98 W100

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003823	antigen binding

	Biological Process
GO:0002250	adaptive immune response
GO:0016064	immunoglobulin mediated immune response

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005886	plasma membrane
GO:0019814	immunoglobulin complex
GO:0070062	extracellular exosome
GO:0071735	IgG immunoglobulin complex
GO:0072562	blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:3c2a, PDBe:3c2a, PDBj:3c2a
PDBsum	3c2a
PubMed	18566514
UniProt	P0DOY2\|IGLC2_HUMAN Immunoglobulin lambda constant 2 (Gene Name=IGLC2)