Structure of PDB 1e4x Chain L Binding Site BS01

Receptor Information

>1e4x Chain L (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQTPSSLSASLGDRVTISCRASQDISHYLNWFQQKPDGTVKLLIYY
TSTLHSGVPSRFSGSGSGTDYSLTISNLEEEDIAFYFCQQGGALPFTFGS
GTKLAIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNEC

Ligand information

>1e4x Chain P (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VVSHFND

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1e4x Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y32 N34 Y49 Y50 Q89 G91 G92 L94 F96
Binding residue (residue number reindexed from 1)	Y32 N34 Y49 Y50 Q89 G91 G92 L94 F96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0030183	B cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1e4x, PDBe:1e4x, PDBj:1e4x
PDBsum	1e4x
PubMed	11718562
UniProt	P01837\|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]