Structure of PDB 7z2z Chain K Binding Site BS01

Receptor Information
>7z2z Chain K (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGY
SIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKS
M
Ligand information
>7z2z Chain W (length=16) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SRDTWNTKNMRSLEPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z2z Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		I139 K140
Binding residue
(residue number reindexed from 1)		I98 K99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042254 ribosome biogenesis
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z2z, PDBe:7z2z, PDBj:7z2z
PDBsum7z2z
PubMed36977686
UniProtP28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 (Gene Name=RPC19)

[Back to BioLiP]