Structure of PDB 7jwp Chain K Binding Site BS01

Receptor Information
>7jwp Chain K (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGGLVTPGTPLTLTCTVSGIDLSRYAMSWVRQAPGKGLEWIGIF
GSLGGIFYASWAKGRFTISKTSPTTVDLKITSPTTEDTATYFCARMPYTT
DRDFWGPGTLVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
TKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jwp Discovery of a caspase cleavage motif antibody reveals insights into noncanonical inflammasome function.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
G51 S52 L53 G55 F57 R95 P97 Y98 T99
Binding residue
(residue number reindexed from 1)
G51 S52 L53 G55 F57 R95 P97 Y98 T99
External links