Structure of PDB 4xgz Chain J Binding Site BS01

Receptor Information
>4xgz Chain J (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISEVQLVESGGGLVQPGGSLRLSCAASGFNVSYSSIHWVRQAPGKGLEWV
ASIYSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAR
GYYGAAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xgz Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y31 S32 S33 Y52 Y54 Y56 Y58 G95 Y96 A99
Binding residue
(residue number reindexed from 1)		Y33 S34 S35 Y54 Y57 Y59 Y61 G101 Y102 A105
External links