Structure of PDB 3fp7 Chain J Binding Site BS01

Receptor Information

>3fp7 Chain J (length=43) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA

Ligand information

>3fp7 Chain I (length=15) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPDFCLEPPYTGPCK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3fp7 Structure of a serine protease poised to resynthesize a peptide bond.
Resolution	1.46 Å
Binding residue (original residue number in PDB)	A16 F22 Y23 F33 V34 G36 C38 R39 K41 R42 N43 C55 G56 G57
Binding residue (residue number reindexed from 1)	A1 F7 Y8 F18 V19 G21 C23 R24 K26 R27 N28 C40 G41 G42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004867	serine-type endopeptidase inhibitor activity

View graph for
Molecular Function

External links

PDB	RCSB:3fp7, PDBe:3fp7, PDBj:3fp7
PDBsum	3fp7
PubMed	19549826
UniProt	P00974\|BPT1_BOVIN Pancreatic trypsin inhibitor

[Back to BioLiP]