BioLiP

Structure of PDB 4jsu Chain I Binding Site BS01

Receptor Information

>4jsu Chain I (length=204) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFL
GITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFG
PYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCE
SLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK
MRQD

Ligand information

>4jsu Chain e (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aYAW

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4jsu Dimerized linear mimics of a natural cyclopeptide (TMC-95A) are potent noncovalent inhibitors of the eukaryotic 20S proteasome
Resolution	2.9 Å
Binding residue (original residue number in PDB)	F99 P101 L125 I126
Binding residue (residue number reindexed from 1)	F99 P101 L125 I126

Enzymatic activity

Enzyme Commision number

3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0061133	endopeptidase activator activity

	Biological Process
GO:0010499	proteasomal ubiquitin-independent protein catabolic process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603	proteolysis involved in protein catabolic process

	Cellular Component
GO:0000502	proteasome complex
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005839	proteasome core complex
GO:0019774	proteasome core complex, beta-subunit complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:4jsu, PDBe:4jsu, PDBj:4jsu
PDBsum	4jsu
PubMed	23540790
UniProt	P25451\|PSB3_YEAST Proteasome subunit beta type-3 (Gene Name=PUP3)