Structure of PDB 2igf Chain H Binding Site BS01

Receptor Information
>2igf Chain H (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGDLVKPGGSLKLSCAASGFTFSRCAMSWVRQTPEKRLEWVAG
ISSGGSYTFYPDTVKGRFIISRNNARNTLSLQMSSLRSEDTAIYYCTRYS
SDPFYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKG
YFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVT
CNVAHPASSTKVDKKIVPRDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2igf Crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 A.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R31 I51 S52 S52A G53 S55 Y56 F58 Y95 P99
Binding residue
(residue number reindexed from 1)		R31 I51 S52 S53 G54 S56 Y57 F59 Y99 P103
External links