Structure of PDB 1uwx Chain H Binding Site BS01

Receptor Information
>1uwx Chain H (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGPELKKPGETVKLSCKASGYTFTNFGLNWMKQAPGKGLKWMGWI
NTYTGESTYADDFKGRFAFSLETSASTAYLQINNVKNEDTATYFCARGFY
YYGSRYFYFDYWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFP
EPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNV
AHPASSTKVDKKIEPRGP
Ligand information
>1uwx Chain P (length=13) Species: 487 (Neisseria meningitidis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HFVQQTPKSQPTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uwx Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		T30 N31 F32 G33 W50 N52 T52A Y97 Y98 Y99 F100D
Binding residue
(residue number reindexed from 1)		T29 N30 F31 G32 W49 N51 T52 Y100 Y101 Y102 F107
External links