Structure of PDB 1bbr Chain H Binding Site BS01

Receptor Information

>1bbr Chain H (length=150) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT

Ligand information

>1bbr Chain F (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DFLAEGGGVR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1bbr The structure of residues 7-16 of the A alpha-chain of human fibrinogen bound to bovine thrombin at 2.3-A resolution.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	H57 K97 E97A N98
Binding residue (residue number reindexed from 1)	H43 K93 E94 N95

Enzymatic activity

Enzyme Commision number

3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1bbr, PDBe:1bbr, PDBj:1bbr
PDBsum	1bbr
PubMed	1560020
UniProt	P00735\|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]