Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 8zcj Chain G Binding Site BS01

Receptor Information
>8zcj Chain G (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLG
LPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVV
HPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPE
PVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRS
ERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVIL
SYANSCANPVLYGFLSDNFRQSFQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zcj Structural insights into somatostatin receptor 5 bound with cyclic peptides.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		Y89 Q99 D119 G120 Q123 T185 I202 F264 N268 N271 L272 Q278 S282 A283 Y286
Binding residue
(residue number reindexed from 1)		Y47 Q57 D77 G78 Q81 T143 I160 F222 N226 N229 L230 Q236 S240 A241 Y244
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004994 somatostatin receptor activity
GO:0005515 protein binding
GO:0042923 neuropeptide binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007218 neuropeptide signaling pathway
GO:0008285 negative regulation of cell population proliferation
GO:0032467 positive regulation of cytokinesis
GO:0038170 somatostatin signaling pathway
GO:0050796 regulation of insulin secretion
GO:0071385 cellular response to glucocorticoid stimulus
Cellular Component
GO:0005886 plasma membrane
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8zcj, PDBe:8zcj, PDBj:8zcj
PDBsum8zcj
PubMed38926478
UniProtP07550|ADRB2_HUMAN Beta-2 adrenergic receptor (Gene Name=ADRB2);
P35346|SSR5_HUMAN Somatostatin receptor type 5 (Gene Name=SSTR5)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417