Structure of PDB 8vy8 Chain G Binding Site BS01

Receptor Information
>8vy8 Chain G (length=75) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCP
SKKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vy8 Structure of recombinant alpha bungarotoxin complexed with HAP peptide at 2.4 Angstroms resolution.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A13 V14 T15
Binding residue
(residue number reindexed from 1)		A14 V15 T16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vy8, PDBe:8vy8, PDBj:8vy8
PDBsum8vy8
PubMed38347541
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]