Structure of PDB 8qtt Chain G Binding Site BS01

Receptor Information
>8qtt Chain G (length=236) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVA
YKNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICD
GILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHT
LAAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQA
FDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qtt Mechanistic insights into the function of 14-3-3 proteins as negative regulators of brassinosteroid signaling.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		K53 R60 R133 Y134 L178 N179 L226 N230 W234
Binding residue
(residue number reindexed from 1)		K52 R59 R132 Y133 L177 N178 L225 N229 W233
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009742 brassinosteroid mediated signaling pathway
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qtt, PDBe:8qtt, PDBj:8qtt
PDBsum8qtt
PubMed38783418
UniProtQ01525|14332_ARATH 14-3-3-like protein GF14 omega (Gene Name=GRF2)

[Back to BioLiP]