Structure of PDB 8k5o Chain G Binding Site BS01

Receptor Information
>8k5o Chain G (length=62) Species: 1052 (Halorhodospira halochloris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRTGLTDEECQEIHEMNMLGMHAYWSIGLIANALAYAWRPFHQGRAGNRL
EDHAPDYVRSAL
Ligand information
>8k5o Chain 8 (length=28) Species: 1052 (Halorhodospira halochloris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GDAGIVVAVLVILAILGWPNISSTLRRW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		Q14 H17 L22 H25 A26 S29 L32 I33 A36 Y39 A40
Binding residue
(residue number reindexed from 1)		Q11 H14 L19 H22 A23 S26 L29 I30 A33 Y36 A37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0046872 metal ion binding
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8k5o, PDBe:8k5o, PDBj:8k5o
PDBsum8k5o
PubMed38411333
UniProtA0A0X8X9B2

[Back to BioLiP]