Structure of PDB 6tq0 Chain G Binding Site BS01

Receptor Information

>6tq0 Chain G (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSV
KNWVEFKKEFLQYSEG

Ligand information

>6tq0 Chain H (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PGCFRMR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6tq0 Structural properties and peptide ligand binding of the capsid homology domains of human Arc.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	F214 E215 P217 F220 Y227 H245 N247 A250 F271 Y274 S275
Binding residue (residue number reindexed from 1)	F3 E4 P6 F9 Y16 H34 N36 A39 F60 Y63 S64

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding

	Biological Process
GO:0050804	modulation of chemical synaptic transmission
GO:2000969	positive regulation of AMPA receptor activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6tq0, PDBe:6tq0, PDBj:6tq0
PDBsum	6tq0
PubMed	33732907
UniProt	Q7LC44\|ARC_HUMAN Activity-regulated cytoskeleton-associated protein (Gene Name=ARC)

[Back to BioLiP]