Structure of PDB 1efr Chain G Binding Site BS01

Receptor Information
>1efr Chain G (length=122) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYLCGAIH
SSVAKQMKLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTF
NRTRQAVITKELIEIISGAAAL
Ligand information
>1efr Chain Q (length=16) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGKGGLAGGGKGGLGt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1efr The Structure of Bovine F1-ATPase Complexed with the Peptide Antibiotic Efrapeptin.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T7 F250
Binding residue
(residue number reindexed from 1)		T7 F100
Enzymatic activity
Enzyme Commision number 3.6.1.34: Transferred entry: 7.1.2.2.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1efr, PDBe:1efr, PDBj:1efr
PDBsum1efr
PubMed8790345
UniProtP05631|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial (Gene Name=ATP5F1C)

[Back to BioLiP]